DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and ucp-4

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_505414.1 Gene:ucp-4 / 179315 WormBaseID:WBGene00006729 Length:324 Species:Caenorhabditis elegans


Alignment Length:278 Identity:61/278 - (21%)
Similarity:116/278 - (41%) Gaps:30/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQLLSHPMELVRVNMQANVIHHSRLSINHM----FRLMARHGLPGFYYGIVAACLRCTVHT---M 70
            |:.:::|:::.:..:|   |..::.:...|    :.::.|.|....:.|:..|..|..::|   |
 Worm    37 AETVTYPLDITKTRLQ---IARNKFTKGGMVQVTYDIIRREGAMALWTGVAPAITRHYIYTGIRM 98

  Fly    71 STYTLFYNLQDNKYVLMLQPYNTSMVLG-ITGFWGGVLATPFAKLAVIRQAD-LTRGSYERRNYR 133
            ..|.....|..||.|....|...||:.| .:|......|:|...:.|..|.: |.|...:...|.
 Worm    99 GAYEQIRLLTFNKEVEKSFPLWKSMLCGAFSGLIAQFAASPTDLVKVQMQMEGLRRLQKQPLRYT 163

  Fly   134 NFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKV-HTVISWFHRLDEPWLSDLITM 197
            ......:.:|...||..|:.||..|...:..:.:......|.| |.:|..| .|.:.||:..:..
 Worm   164 GATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSVKHGLIDNF-ELKDNWLTHAVAS 227

  Fly   198 ALTGSIITVIMTPVDALATLTLNESSH-------YGRTSYPYLYR-------KIIRKHGYKGFFF 248
            |..|....::..|.|.:.|..:::..|       :.:.::..||:       |||:..|:...:.
 Worm   228 ACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDLYKGVVDCYIKIIKNEGFFSLYK 292

  Fly   249 GWKPALMALIPHTVLATF 266
            |:.|:.:.:.|.::  ||
 Worm   293 GFLPSYIRMAPWSL--TF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 14/74 (19%)
Mito_carr 187..277 CDD:278578 19/94 (20%)
ucp-4NP_505414.1 PTZ00169 20..317 CDD:240302 61/278 (22%)
Mito_carr 22..111 CDD:278578 14/76 (18%)
Mito_carr 115..214 CDD:278578 23/98 (23%)
Mito_carr <240..318 CDD:278578 15/71 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.