DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Slc25a10

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:277 Identity:72/277 - (25%)
Similarity:127/277 - (45%) Gaps:26/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YVGLLIKTTAQLLSHPMELVRVNMQANVIHHSRLSINHM-FRLMARHGLPGFYYGIVAACLRCTV 67
            |.|.|....|...:||::|::|::|..  ...:|.:..| .:::...|....|.|:.|:..|...
  Rat    10 YFGGLASCGAACCTHPLDLLKVHLQTQ--QEVKLRMTGMALQVVRTDGFLALYNGLSASLCRQMT 72

  Fly    68 HTMSTYTLF-----YNLQDNKYVLMLQPYNTSMVL-GITGFWGGVLATPFAKLAVIRQADLTRGS 126
            ::::.:.::     |..:|::..|   |:.:.::| ||:|..||.:.||...:.|..|.|:....
  Rat    73 YSLTRFAIYETMRDYMTKDSQGPL---PFYSKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPL 134

  Fly   127 YERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWL 191
            .:||||.:...||..:..:.|...||:|..:.|.....|.|......|:...::     |...:|
  Rat   135 SQRRNYSHALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSCYDQAKQLV-----LSTGYL 194

  Fly   192 SD-----LITMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLYRKIIRKHGYKGFFFGWK 251
            ||     .::..:.|...|.:..|:|.|.|..:|....|....:..:.   ..|.|.:.||.|..
  Rat   195 SDNIFTHFLSSFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAVE---TAKLGPQAFFKGLV 256

  Fly   252 PALMALIPHTVLATFVY 268
            ||.:.|:||||| ||::
  Rat   257 PAGVRLVPHTVL-TFMF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 16/80 (20%)
Mito_carr 187..277 CDD:278578 26/87 (30%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 16/81 (20%)
Mito_carr 94..189 CDD:395101 27/102 (26%)
Mito_carr 197..283 CDD:395101 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.