DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and SLC25A10

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:172 Identity:45/172 - (26%)
Similarity:83/172 - (48%) Gaps:8/172 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YVGLLIKTTAQLLSHPMELVRVNMQANVIHHSRLSINHM-FRLMARHGLPGFYYGIVAACLRCTV 67
            |.|.|....|...:||::|::|::|..  ...:|.:..| .|::...|:...|.|:.|:..|...
Human    11 YFGGLASCGAACCTHPLDLLKVHLQTQ--QEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMT 73

  Fly    68 HTMSTYTLFYNLQDN--KYVLMLQPYNTSMVLG-ITGFWGGVLATPFAKLAVIRQADLTRGSYER 129
            ::::.:.::..::|.  |......|::..::|| ::|..||.:.||...:.|..|.|:.....:|
Human    74 YSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQR 138

  Fly   130 RNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAV--LY 169
            |||.:...||..:..:.|...||:|..:.|.....|.|  ||
Human   139 RNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 16/75 (21%)
Mito_carr 187..277 CDD:278578
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 18/81 (22%)
Mito_carr 95..179 CDD:278578 24/83 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.