DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and slc25a10a

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_002661286.1 Gene:slc25a10a / 100332610 ZFINID:ZDB-GENE-131127-11 Length:288 Species:Danio rerio


Alignment Length:274 Identity:66/274 - (24%)
Similarity:118/274 - (43%) Gaps:20/274 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YVGLLIKTTAQLLSHPMELVRVNMQANVIHHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTVH 68
            |.|.:....|...:||::|::|::|.......|:: ....:::...|:...|.|:.|:..|...:
Zfish    10 YFGGIASCAAACCTHPLDLIKVHLQTQQEVKMRMT-GMAVQVVRSDGVFALYNGLSASLCRQMSY 73

  Fly    69 TMSTYTLFYNLQDNKYVLMLQP---YNTSMVLGITGFWGGVLATPFAKLAVIRQADLTRGSYERR 130
            :|:.:.::..::|........|   |...::....||.||.:.||...:.|..|.|:......||
Zfish    74 SMTRFAIYETVRDQIASQNQGPMPFYQKILLAAFGGFTGGFIGTPADMVNVRMQNDMKLPPVLRR 138

  Fly   131 NYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLI 195
            ||.:...||..:..:.|...||:|..:.:.....|.|......|:...::.....:.:...:..:
Zfish   139 NYAHALDGLLRVLKEEGIRKLFSGASMAASRGALVTVGQLSCYDQAKQLVLGTGLMTDNIFTHFV 203

  Fly   196 TMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLYRKIIR------KHGYKGFFFGWKPAL 254
            ...:.|...||:..|:|.:.|..:|....         ||.:|.      |.|.|.|:.|..||.
Zfish   204 ASFIAGGCATVLCQPMDVVKTRLMNSKGE---------YRGLIHCLSDTGKLGPKAFYKGLVPAG 259

  Fly   255 MALIPHTVLATFVY 268
            :.||||||| ||::
Zfish   260 IRLIPHTVL-TFIF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 14/74 (19%)
Mito_carr 187..277 CDD:278578 26/88 (30%)
slc25a10aXP_002661286.1 Mito_carr 12..86 CDD:278578 14/74 (19%)
Mito_carr 94..190 CDD:278578 24/95 (25%)
Mito_carr 195..281 CDD:278578 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.