DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGEA11 and MAGE

DIOPT Version :9

Sequence 1:NP_005357.2 Gene:MAGEA11 / 4110 HGNCID:6798 Length:429 Species:Homo sapiens
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:163 Identity:42/163 - (25%)
Similarity:82/163 - (50%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   275 FGIDVKEVDPTSHSYVL-----VTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVM 334
            |||.:..:|.|:.:::.     |.|::      :......|:..||.|:|..||:.||.|.:..:
  Fly    77 FGIILTPLDATTKTFICTAEEPVASIH------ELTPAQRPQFTLLYIILMYIFLRGNRIEDSKL 135

Human   335 WEVLSIMGVYAGREHFLFG-EPKRLLTQNWVQEKYLVYR--QVPGTDPACYEFLWGPRAHAETSK 396
            :.:|.::.:|...||..|| ..::.:.:.:|:::||...  |:...|.:...|||||||.||.:.
  Fly   136 YVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTF 200

Human   397 MKVLEYIANANGRDPTSYPSLYEDALREEGEGV 429
            .:::::.:....:    :|.::...|....|||
  Fly   201 EQMVQFASKLLNQ----HPKVFGHHLSMAQEGV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGEA11NP_005357.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
MAGE_N 115..204 CDD:289225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..215
MAGE 243..397 CDD:279759 37/129 (29%)
MAGENP_649702.2 MAGE 36..201 CDD:279759 37/129 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151972
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.