DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARSB and Sgsh

DIOPT Version :9

Sequence 1:NP_000037.2 Gene:ARSB / 411 HGNCID:714 Length:533 Species:Homo sapiens
Sequence 2:NP_650760.1 Gene:Sgsh / 42266 FlyBaseID:FBgn0038660 Length:524 Species:Drosophila melanogaster


Alignment Length:580 Identity:131/580 - (22%)
Similarity:225/580 - (38%) Gaps:170/580 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    26 LLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQ-P 89
            :..|.|:|  |..||   |.:::.|||||.|:....:.....:||:|||||..|:|.:|.:|. .
  Fly     7 IFTLWLIA--GCSAG---PQNVLLLLADDAGFESGAYLNKFCQTPNLDALAKRGLLFNNAFTSVS 66

Human    90 LCTPSRSQLLTGR-------YQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAG---YTTHMVG 144
            .|:|||||||||:       |.:..|:.:..:.|        |...||.|:::..   ..:.::|
  Fly    67 SCSPSRSQLLTGQAGHSSGMYGLHQGVHNFNVLP--------DTGSLPNLIRDQSGGRILSGIIG 123

Human   145 KWHLGM-----------------------------YRKECLPTRRGFDTYFGYLLGSEDYYSHER 180
            |.|:|.                             |.::.|...:.....|..::|   ::...|
  Fly   124 KKHVGAANNFRFDFEQTEEQHSINQIGRNITRMKEYARQFLKQAKDEKKPFFLMVG---FHDPHR 185

Human   181 CTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPL 245
            |..|.......|       |...:|.:.|.|.              |..||  :|...:::..|.
  Fly   186 CGHITPQFGEFC-------ERWGSGEEGMGSI--------------PDWKP--IYYDWRNLDVPA 227

Human   246 QVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGN 310
            .:|:.     |.::.:....|. .:|.:|:.||.:...|:::|:.:.|:.|:::|||.       
  Fly   228 WLPDT-----DVVRQELAAQYM-TISRLDQGVGLMLKELEAAGVADQTLVIYTSDNGP------- 279

Human   311 NWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFD 375
              |..|.:.:|:|.|:|....::||        |:|              .|.|......:...|
  Fly   280 --PFPGGRTNLYEHGIRSPLIISSP--------NKE--------------DRHHEATAAMVSLLD 320

Human   376 VWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEY-SAFNT-SVHAA------ 432
            ::.::.:....||        ||  |:....|:.:...:::..:.|. |.|.: |.|..      
  Fly   321 IYPSVMDALQIPR--------PN--DTKIVGRSILPVLREEPPIKESDSVFGSHSYHEVTMAYPM 375

Human   433 --IRHGNWKLLTGYPGCGYW--FPPPSQYNVS----EIPSSDPPTKTL--------------W-L 474
              :|:..:||:   ....||  ||....:..|    :|.::....:||              | |
  Fly   376 RMVRNRRYKLI---HNINYWADFPIDQDFYTSPTFQQILNATLRKQTLPWYRSLLQYYQRPEWEL 437

Human   475 FDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDP-RCDPKAT----GVW 529
            :||..||.||.:|:.:..:..|....|.|.:...     ...:|| ||.|.|.    ||:
  Fly   438 YDIKTDPLERFNLADKAKYNGTLKQLREQLFDWQ-----VATKDPWRCAPHAVLQEQGVY 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARSBNP_000037.2 AslA 41..489 CDD:225661 114/518 (22%)
4-S 45..488 CDD:293753 112/513 (22%)
SgshNP_650760.1 AslA 17..476 CDD:225661 119/550 (22%)
SGSH 22..471 CDD:293751 116/532 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.