DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SOT16

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_177550.1 Gene:SOT16 / 843750 AraportID:AT1G74100 Length:338 Species:Arabidopsis thaliana


Alignment Length:275 Identity:84/275 - (30%)
Similarity:130/275 - (47%) Gaps:33/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHETVAQ-----KF 115
            |..:.|||:||:||.:.:.:.:.::..|..|...|..|:|            ||.|..     .|
plant    73 DFLVCSYPKTGTTWLKALTYAIVNRSRYDDAANPLLKRNP------------HEFVPYVEIDFAF 125

  Fly   116 GNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVS---YYHYFKLLHGMNG 177
            ..|||::::...|.|: :|:|..|||:.......::||..|:|||..:|   :.|..|...|...
plant   126 YPTVDVLQDRKNPLFS-THIPNGLLPDSIVNSGCKMVYIWRDPKDTFISMWTFLHKEKSQEGQLA 189

  Fly   178 DFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQD--DNVLFIKYEDMVKDLPSVVRRCARFLGVQSL 240
            ..|...|:|.:|.:..|.|..|||.:||..|:  |.:||::||.|..:....|:|.|.|:| ...
plant   190 SLEDSFDMFCKGLSVYGPYLDHVLGYWKAYQENPDRILFLRYETMRANPLPFVKRLAEFMG-YGF 253

  Fly   241 LD-------VSTLQKLCDHLTFDKMRANKAVNLEKLLPE--SSSKFIRNGKIGDWRNHMGNEMSE 296
            .|       ...:.|||...|...:.|||.....:..|.  ::|.:.|.||:|||.|::..||:.
plant   254 TDEEEENGVAEKVVKLCSFETLKNLEANKGDKEREDRPAVYANSAYFRKGKVGDWANYLTPEMAA 318

  Fly   297 RFDEWTERHMRGSGL 311
            |.|...|...:.:||
plant   319 RIDGLVEEKFKDTGL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 82/272 (30%)
SOT16NP_177550.1 PLN02164 1..338 CDD:177822 84/275 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.