DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SOT18

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_177549.1 Gene:SOT18 / 843749 AraportID:AT1G74090 Length:350 Species:Arabidopsis thaliana


Alignment Length:277 Identity:80/277 - (28%)
Similarity:130/277 - (46%) Gaps:37/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHETVAQ-----KF 115
            |..:.|||:||:||.:.:.:.:.::..:..:...|..|:|            ||.|..     .|
plant    85 DFLVCSYPKTGTTWLKALTFAIANRSRFDDSSNPLLKRNP------------HEFVPYIEIDFPF 137

  Fly   116 GNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLH------G 174
            ...||::::.....|: :|:|:.|||:.......::||..|.|||..:|.:.:   ||      |
plant   138 FPEVDVLKDKGNTLFS-THIPYELLPDSVVKSGCKMVYIWREPKDTFISMWTF---LHKERTELG 198

  Fly   175 MNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQD--DNVLFIKYEDMVKDLPSVVRRCARFLGV 237
            ...:.|:..|:|..|.:..|.|..|:|.:||..|:  |.:||:|||.|..|....|:..|.|:|.
plant   199 PVSNLEESFDMFCRGLSGYGPYLNHILAYWKAYQENPDRILFLKYETMRADPLPYVKSLAEFMGH 263

  Fly   238 QSLLD------VSTLQKLCDHLTFDKMRANKAVNLEKLLP--ESSSKFIRNGKIGDWRNHMGNEM 294
            ....:      |..:..||...|...:.|||.....:..|  .::|.:.|.||:|||.|::..||
plant   264 GFTAEEEEKGVVEKVVNLCSFETLKNLEANKGEKDREDRPGVYANSAYFRKGKVGDWSNYLTPEM 328

  Fly   295 SERFDEWTERHMRGSGL 311
            :.|.|...|...:|:||
plant   329 AARIDGLMEEKFKGTGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 78/274 (28%)
SOT18NP_177549.1 PLN02164 18..350 CDD:177822 80/277 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.