DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and ST4B

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_172799.1 Gene:ST4B / 837902 AraportID:AT1G13420 Length:331 Species:Arabidopsis thaliana


Alignment Length:276 Identity:76/276 - (27%)
Similarity:133/276 - (48%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHETVAQKFGNT 118
            :.|:.:.|:|::|:||.:.:.:.|..:..:.:....|...:| .||.....:|.:...::.    
plant    70 ETDIIVASFPKSGTTWLKALTFALAQRSKHTSDNHPLLTHNP-HELVPYLELDLYLKSSKP---- 129

  Fly   119 VDLVRNLP--RPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMNG-DFE 180
             ||.: ||  .||...:|:.:..|....:....:|||..||.||:.||.:.:...:.|.|. ..|
plant   130 -DLTK-LPSSSPRLFSTHMSFDALKVPLKESPCKIVYVCRNVKDVLVSLWCFENSMSGENNLSLE 192

  Fly   181 QFVDLFLEGHTPMGSYWRHVLPFWKRSQDD--NVLFIKYEDMVKDLPSV-VRRCARFL------- 235
            ...:....|....|..|.:||.:|:.|.:|  :|||::||:: |..|.| ::|.|.||       
plant   193 ALFESLCSGVNLCGPLWENVLGYWRGSLEDPKHVLFLRYEEL-KTEPRVQIKRLAEFLDCPFTKE 256

  Fly   236 -----GVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWRNHMGNEMS 295
                 ||..:|::.:|:.|      ..:..||..:|.:.:  |...|.|.|::|||:::|..||.
plant   257 EEDSGGVDKILELCSLRNL------SGLEINKTGSLSEGV--SFKSFFRKGEVGDWKSYMTPEME 313

  Fly   296 ERFDEWTERHMRGSGL 311
            .:.|...|..::||||
plant   314 NKIDMIVEEKLQGSGL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 73/272 (27%)
ST4BNP_172799.1 Sulfotransfer_1 43..329 CDD:304426 74/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.