DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and AT5G43690

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_199182.1 Gene:AT5G43690 / 834389 AraportID:AT5G43690 Length:331 Species:Arabidopsis thaliana


Alignment Length:329 Identity:85/329 - (25%)
Similarity:135/329 - (41%) Gaps:83/329 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IRSLPVYQD---------------------------------DVWMVSYPRTGSTWAQEMVWLLG 78
            |.|||.|||                                 |:.:.|:|::|:||.:       
plant    24 ISSLPTYQDSHVKLCKYQGCWYYHNTLQAVINYQRNFQPQDTDIILASFPKSGTTWLK------- 81

  Fly    79 HQLDYVAAEQ------DLRLRSPLIE-----LSALFSIDHHETVAQKFGNTVDLVR-NLPRPRFA 131
             .|.....|:      |..|..||:.     :...|..|.:...     :|.||.: :...||..
plant    82 -ALSVAIVERSKQPFDDDPLTHPLLSDNPHGIVPFFEFDMYLKT-----STPDLTKFSTSSPRLF 140

  Fly   132 RSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMN----GDFEQFVDLFLEGHTP 192
            .:|:|.....|..:....::||..||.||:.:|.:| |:..:..|    ...|...:.|..|.:.
plant   141 STHMPLHTFKEGLKGSPCKVVYMCRNIKDVLISDWH-FRSKYSNNEVSRSTLESMFESFCGGVSF 204

  Fly   193 MGSYWRHVLPFWKRSQDD--NVLFIKYEDMVKDLPSV-VRRCARFLGV------QSLLDVSTLQK 248
            .|.:|.|.|.:|:.|.::  :|||::||:| |..|.| |:|.|.|||.      :....:|.|.:
plant   205 YGPFWDHALSYWRGSLENPKHVLFMRYEEM-KTEPCVQVKRLAEFLGFPFTKEEEDSGSISKLLE 268

  Fly   249 LCDHLTFDKMRANKA----VNLEKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGS 309
            ||.......:..||.    :|.:      ...:.|.|::|||:||:..||..:.|...|..::||
plant   269 LCSLGNLSGLEVNKTGKTWMNYD------YKSYFRKGEVGDWKNHLTPEMENKIDMIIEEKLKGS 327

  Fly   310 GLNF 313
            .|.|
plant   328 DLKF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 76/316 (24%)
AT5G43690NP_199182.1 Sulfotransfer_1 21..329 CDD:304426 83/325 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.