DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and ST2A

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_568177.1 Gene:ST2A / 830592 AraportID:AT5G07010 Length:359 Species:Arabidopsis thaliana


Alignment Length:285 Identity:78/285 - (27%)
Similarity:132/285 - (46%) Gaps:44/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QDDVWMVSYPRTGSTWAQEMVW--LLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHETV----- 111
            ::||.:.:.|::|:||.:.:.:  |..|:.|.||:..:          ..||:.:.|:.|     
plant    91 ENDVVLATIPKSGTTWLKALTFTILNRHRFDPVASSTN----------HPLFTSNPHDLVPFFEY 145

  Fly   112 -AQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGM 175
             ....|:..|| ..|..||...:|||:..|.|..|....::||..|||.|..:|.:||...:...
plant   146 KLYANGDVPDL-SGLASPRTFATHLPFGSLKETIEKPGVKVVYLCRNPFDTFISSWHYTNNIKSE 209

  Fly   176 NGD---FEQFVDLFLEGHTPMGSYWRHVLPFWKRS--QDDNVLFIKYEDMVKDLPSVVRRCARFL 235
            :..   .:|..||:..|....|.:|.|:|.:|:.|  :.:.|.|::|||:..|:.:.::|.|.||
plant   210 SVSPVLLDQAFDLYCRGVIGFGPFWEHMLGYWRESLKRPEKVFFLRYEDLKDDIETNLKRLATFL 274

  Fly   236 -----------GVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFI-RNGKIGDWRN 288
                       ||     |..:.:||......|:..||:   .|.:....::|: |.|::.||.|
plant   275 ELPFTEEEERKGV-----VKAIAELCSFENLKKLEVNKS---NKSIKNFENRFLFRKGEVSDWVN 331

  Fly   289 HMGNEMSERFDEWTERHMRGSGLNF 313
            ::.....||.....:..:.||||.|
plant   332 YLSPSQVERLSALVDDKLGGSGLTF 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 74/279 (27%)
ST2ANP_568177.1 Sulfotransfer_1 30..354 CDD:304426 75/281 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.