DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and ST2B

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_196317.2 Gene:ST2B / 830591 AraportID:AT5G07000 Length:347 Species:Arabidopsis thaliana


Alignment Length:284 Identity:78/284 - (27%)
Similarity:137/284 - (48%) Gaps:31/284 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RSLPVYQDDVWMVSYPRTGSTWAQEMVW--LLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHET 110
            :|||   |||.:.:.|::|:||.:.:.:  |..|:.|.|::...   ..||:..:....:...|.
plant    74 QSLP---DDVVLATIPKSGTTWLKALTFTILTRHRFDPVSSSSS---DHPLLTSNPHDLVPFFEY 132

  Fly   111 VAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGM 175
            .....||..|| ..|..||...:|:|:..|.:..|....::||..|||.|..:|.:||   ::.:
plant   133 KLYANGNVPDL-SGLASPRTFATHVPFGALKDSVENPSVKVVYLCRNPFDTFISMWHY---INNI 193

  Fly   176 NGD------FEQFVDLFLEG-HTPMGSYWRHVLPFWKRS--QDDNVLFIKYEDMVKDLPSVVRRC 231
            ..:      .::..||:..| ....|.:|.|:|.:|:.|  :.:.|||:||||:.:|:.:.:::.
plant   194 TSESVSAVLLDEAFDLYCRGLLIGFGPFWEHMLGYWRESLKRPEKVLFLKYEDLKEDIETNLKKL 258

  Fly   232 ARFLGVQSLLD------VSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFI-RNGKIGDWRNH 289
            |.|||:....:      |..:..||......|:..||:   .||:....::|: |.|::.|..|:
plant   259 ASFLGLPFTEEEEQKGVVKAIADLCSFENLKKLEVNKS---SKLIQNYENRFLFRKGEVSDLVNY 320

  Fly   290 MGNEMSERFDEWTERHMRGSGLNF 313
            :.....||.....:..:.||||.|
plant   321 LSPSQVERLSALVDDKLAGSGLTF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 71/272 (26%)
ST2BNP_196317.2 Sulfotransfer_1 17..342 CDD:304426 75/280 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.