DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and AT4G26280

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_194358.1 Gene:AT4G26280 / 828734 AraportID:AT4G26280 Length:314 Species:Arabidopsis thaliana


Alignment Length:274 Identity:64/274 - (23%)
Similarity:115/274 - (41%) Gaps:66/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QD-DVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHETVAQKFGN 117
            || |:.:.|||::|:.|.:.:...|..           |.::|          .|.:.::.    
plant    60 QDTDIIVASYPKSGTLWLKALTVALFE-----------RTKNP----------SHDDPMSH---- 99

  Fly   118 TVDLVRNLPR-------PRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGM 175
              .|:.|.|.       ||...:|.|:..|....:....::||..|:.||..||.:|.  :...:
plant   100 --PLLSNNPHNLLSSSSPRLFSTHTPFHTLQVAVKDSPCKVVYICRDAKDSLVSRWHI--VCRSL 160

  Fly   176 NGD-----FEQFVDLFLEGHTPMGSYWRHVLPFWKRS--QDDNVLFIKYEDMVKDLPSVVRRCAR 233
            |.:     .|...:.|..|....|.:|.|:|.:||.|  :...|||::|:::..|....:::.|.
plant   161 NKEEDRTILESMFESFCSGVCLFGPFWDHILSYWKASLEKPKQVLFMRYDEIKTDPHGQLKKLAE 225

  Fly   234 FLG------------VQSLLDVSTLQKLCDHLTFDKMRANKAVN-LEKLLPESSSKFIRNGKIGD 285
            |||            :..:|::.:|..|.   :.:..:..|::| :|      .....|.|.:||
plant   226 FLGCPFSKEEEKNGSLNKILEMCSLPNLS---SLEVNKTGKSINGIE------YKNHFRKGIVGD 281

  Fly   286 WRNHMGNEMSERFD 299
            |:||:..||..:.|
plant   282 WKNHLTPEMGSKID 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 63/273 (23%)
AT4G26280NP_194358.1 Sulfotransfer_1 17..304 CDD:304426 64/274 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.