DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and AT3G45070

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001327291.1 Gene:AT3G45070 / 823642 AraportID:AT3G45070 Length:355 Species:Arabidopsis thaliana


Alignment Length:287 Identity:77/287 - (26%)
Similarity:134/287 - (46%) Gaps:37/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHETVA 112
            :|......|:.:.|:|:.|:||.:.:.:.|.|:....:.:.|    .||:..:....:.:.|...
plant    85 KSFKPQDTDIIVASFPKCGTTWLKALTFALLHRSKQPSHDDD----HPLLSNNPHVLVPYFEIDL 145

  Fly   113 QKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYF-------K 170
            .......||.:....||...:|:|...|.|..:....:|||.:||.||..|||:|:|       |
plant   146 YLRSENPDLTKFSSSPRLFSTHVPSHTLQEGLKGSTCKIVYISRNVKDTLVSYWHFFTKKQTDEK 210

  Fly   171 LLHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDD--NVLFIKYEDMVKDLPSVVRRCAR 233
            ::    ..||...::|..|.:..|.:|.|||.:|:.|.:|  :|||:|:|:|..:....:::.|.
plant   211 II----SSFEDTFEMFCRGVSIFGPFWDHVLSYWRGSLEDPNHVLFMKFEEMKAEPRDQIKKFAE 271

  Fly   234 FLG------------VQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDW 286
            |||            |..::|:.:|:.|      ..:..||...|..  ...:..|.|.|::|||
plant   272 FLGCPFTKEEEESGSVDEIIDLCSLRNL------SSLEINKTGKLNS--GRENKMFFRKGEVGDW 328

  Fly   287 RNHMGNEMSERFDEWTERHMRGSGLNF 313
            :|::..||..:.|...:..::.|||.|
plant   329 KNYLTPEMENKIDMIIQEKLQNSGLKF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 72/275 (26%)
AT3G45070NP_001327291.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.