DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and AT2G27570

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_180325.1 Gene:AT2G27570 / 817303 AraportID:AT2G27570 Length:273 Species:Arabidopsis thaliana


Alignment Length:277 Identity:71/277 - (25%)
Similarity:116/277 - (41%) Gaps:83/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QD-DVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHETVAQKFGN 117
            || ::.:.|:|:.|:||.:.:.:.|.|           |.:.|        |.|||.        
plant    63 QDTNIIVASFPKCGTTWLKALTFSLVH-----------RSKHP--------SHDHHH-------- 100

  Fly   118 TVDLVRNLPR------PRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMN 176
              .|:.|.|.      ||...:|:|...|.|..:....::||..||.||...::           
plant   101 --PLLSNNPHVLFSSSPRLFSTHMPSHTLQEVLKDSTCKVVYICRNMKDTLETF----------- 152

  Fly   177 GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDD--NVLFIKYEDMVKDLPSVVRRCARFLGVQS 239
                   :.|.:|....|.:|..||.:|:||.:|  :|||:::|:|..:....::|.|.||....
plant   153 -------ESFCKGVNFFGPFWDQVLSYWRRSLEDPNHVLFMRFEEMKAEPHEQIKRLAEFLDSPL 210

  Fly   240 L--------LDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWRNHMGNEMSE 296
            |        |:::...|||:.      |.||.             |.|.|::|||:|::..||..
plant   211 LRKKKRTDCLEINKTGKLCEG------RDNKT-------------FFRKGEVGDWKNYLTPEMEN 256

  Fly   297 RFDEWTERHMRGSGLNF 313
            :.|...:..::.|||.|
plant   257 KIDMIIQEKLQNSGLKF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 66/271 (24%)
AT2G27570NP_180325.1 Sulfotransfer_1 20..271 CDD:304426 68/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.