DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and ST4A

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_179098.1 Gene:ST4A / 815981 AraportID:AT2G14920 Length:333 Species:Arabidopsis thaliana


Alignment Length:351 Identity:85/351 - (24%)
Similarity:148/351 - (42%) Gaps:71/351 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RELEEDILRRTNAVFPVQNCFVEVLPDQFIIPRKYVELGESIRSLP-------VYQDDVWMVSYP 63
            ||.||.....|..:.......::.|.::......|....:.::|:|       ..:.|:.:.|:.
plant    11 REEEEKPSEETKILISSLPWEIDYLGNKLFNYEGYWYSEDILQSIPNIHTGFQPQETDIILASFY 75

  Fly    64 RTGSTWAQEMVW----------------LLGHQLDYVA--AEQDLRLRSPLIELSALFSIDHHET 110
            ::|:||.:.:.:                ||.|....:.  .|.||.|:|...:|:          
plant    76 KSGTTWLKALTFALVQRSKHSLEDHQHPLLHHNPHEIVPNLELDLYLKSSKPDLT---------- 130

  Fly   111 VAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYF----KL 171
               ||     |..:...||...:|:....|....:....:|||..||.||:.||.: ||    |:
plant   131 ---KF-----LSSSSSSPRLFSTHMSLDPLQVPLKENLCKIVYVCRNVKDVMVSVW-YFRQSKKI 186

  Fly   172 LHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDD--NVLFIKYEDMVKDLPSVVRRCARF 234
            ....:...|...:.|..|.|..|.:|.|.|.:|:.|.:|  :.||::|||:..:..:.|:|.|.|
plant   187 TRAEDYSLEAIFESFCNGVTLHGPFWDHALSYWRGSLEDPKHFLFMRYEDLKAEPRTQVKRLAEF 251

  Fly   235 L------------GVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWR 287
            |            .|..:|::.:|..| ..:..:|.|.:..|:.:        .:.|.|::|||:
plant   252 LDCPFTKEEEDSGSVDKILELCSLSNL-RSVEINKTRTSSRVDFK--------SYFRKGQVGDWK 307

  Fly   288 NHMGNEMSERFDEWTERHMRGSGLNF 313
            ::|..||.::.|...|..::||||.|
plant   308 SYMTPEMVDKIDMIIEEKLKGSGLKF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 72/290 (25%)
ST4ANP_179098.1 Sulfotransfer_1 66..330 CDD:279075 72/291 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.