DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and AT2G03770

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_178472.1 Gene:AT2G03770 / 814904 AraportID:AT2G03770 Length:324 Species:Arabidopsis thaliana


Alignment Length:270 Identity:81/270 - (30%)
Similarity:132/270 - (48%) Gaps:27/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHETVAQKFGNTVD 120
            |:.:.|.|::|:||.:.:|:.|.|:.::         ::||:....|   |::......|.....
plant    68 DIVLASIPKSGTTWLKSLVFALIHRQEF---------QTPLVSHPLL---DNNPHTLVTFIEGFH 120

  Fly   121 LVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFK--LLHGMNG-DFEQF 182
            |......||...:|:|...|||..:....::||..|||||..||.:|:.|  ::..|.| ..|:.
plant   121 LHTQDTSPRIFSTHIPVGSLPESVKDSSCKVVYCCRNPKDAFVSLWHFMKNLIVKEMVGCTMEEM 185

  Fly   183 VDLFLEGHTPMGSYWRHVLPFWKRSQDD--NVLFIKYEDMVKDLPSVVRRCARFLG---VQSLLD 242
            |..|..|.:..|.:|.|||.:||.|:::  .|:|:.||:|.:.....|.|.|.|||   .:..::
plant   186 VRFFCRGSSIYGPFWDHVLQYWKESRENPKKVMFVMYEEMREQPQEWVMRIAEFLGYSFTEEEIE 250

  Fly   243 VSTLQ---KLCDHLTFDKMRANKAVNLEKLLPESSSK-FIRNGKIGDWRNHMGNEMSERFDEWTE 303
            ...|:   |||......|:..|:.   .|||....:| |.|.|:||.||:.:...::|..|:.|:
plant   251 NGVLEDIIKLCSLENLSKLEVNEK---GKLLNGMETKAFFRKGEIGGWRDTLTPLLAEEIDKTTK 312

  Fly   304 RHMRGSGLNF 313
            ..:.||...|
plant   313 EKLIGSDFRF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 79/265 (30%)
AT2G03770NP_178472.1 Sulfotransfer_3 22..320 CDD:419727 80/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.