DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and AT2G03750

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_565305.1 Gene:AT2G03750 / 814902 AraportID:AT2G03750 Length:351 Species:Arabidopsis thaliana


Alignment Length:284 Identity:85/284 - (29%)
Similarity:131/284 - (46%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQ--DLRLRSPLIELSALFSIDHHETV----AQK 114
            |:.:.|.|:.|:||.:.:::.:.|:..|....|  .|.|::|            |:.|    .:.
plant    90 DIILASLPKGGTTWLKSLIFAVVHREKYRGTPQTHPLLLQNP------------HDLVPFLEVEL 142

  Fly   115 FGNT--VDLVRNLPRPRFARSHLPWPLLPEQFETVKP-RIVYTARNPKDLCVSYYHYFKLLHGMN 176
            :.|:  .||.: ...|....:|:....|.|  .|.|. :.||..|..||..||.:||..:||...
plant   143 YANSQIPDLAK-YSSPMIFSTHMHLQALRE--ATTKACKTVYVCRGIKDTFVSGWHYRNMLHRTK 204

  Fly   177 GD---FEQFVDLFLEGHTPMGSYWRHVLPFWKRSQD--DNVLFIKYEDMVKDLPSVVRRCARFL- 235
            .|   ||...|.:..|....|.||.|||.:||.|.:  :||||:|||:::::....|:|.|.|| 
plant   205 MDQATFELMFDAYCRGVLLYGPYWEHVLSYWKGSLEAKENVLFMKYEEIIEEPRVQVKRLAEFLE 269

  Fly   236 -----------GVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWRNH 289
                       .|:.:|      |||.......:..||  |....:...|..|.|.|::|||:||
plant   270 CPFTKEEEESGSVEEIL------KLCSLRNLSNLEVNK--NGTTRIGVDSQVFFRKGEVGDWKNH 326

  Fly   290 MGNEMSERFDEWTERHMRGSGLNF 313
            :..:|::.|||..:..:..|||.|
plant   327 LTPQMAKTFDEIIDYRLGDSGLIF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 81/279 (29%)
AT2G03750NP_565305.1 Sulfotransfer_1 88..347 CDD:279075 81/279 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.