DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult4a1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001072322.1 Gene:sult4a1 / 779775 XenbaseID:XB-GENE-979812 Length:284 Species:Xenopus tropicalis


Alignment Length:273 Identity:93/273 - (34%)
Similarity:146/273 - (53%) Gaps:28/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHE 109
            |.|...||.::|:|:|:||::|::..||:|:|:..     .|:.|        |: .|.:||...
 Frog    36 EEISDFPVRKNDIWIVTYPKSGTSLLQEVVYLVSQ-----GADPD--------EI-GLMNIDEQL 86

  Fly   110 TVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHG 174
            .|.:.....:|:::.|..||..:||||:..||........:::|.|||||||.||||.:.:.|..
 Frog    87 PVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGNSKVIYMARNPKDLVVSYYQFHRSLRT 151

  Fly   175 MN--GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGV 237
            |:  |.|::|...|:......||::.||..||....|.||||:|||||.|||.::|.:..|||||
 Frog   152 MSYRGTFQEFCRRFMNDKLGYGSWFDHVQEFWDHRLDSNVLFLKYEDMHKDLGTMVEQLVRFLGV 216

  Fly   238 QSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWT 302
            .  .|.:.|:...:|.   .:..::..|.| .||      |..|::|.|::.....|:|:||...
 Frog   217 S--YDKAQLESTIEHC---HLLIDQCCNAE-ALP------IGRGRVGLWKDIFTVSMNEKFDLVY 269

  Fly   303 ERHMRGSGLNFDY 315
            ::.|..|.|.|::
 Frog   270 KQRMGKSDLTFEF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 86/256 (34%)
sult4a1NP_001072322.1 Sulfotransfer_1 47..277 CDD:366246 86/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.