DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult2st2

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001071637.1 Gene:sult2st2 / 777793 ZFINID:ZDB-GENE-061117-5 Length:287 Species:Danio rerio


Alignment Length:293 Identity:86/293 - (29%)
Similarity:144/293 - (49%) Gaps:56/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SLPVYQ------DDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRL--------RSPLIE- 98
            ||..|:      ||:.:|:||::|:.|.||:|.|       |.:|.||.|        |.|.:| 
Zfish    24 SLKYYEDFIFRPDDILIVTYPKSGTIWMQEIVPL-------VVSEGDLTLVLTVPNWDRVPWLEE 81

  Fly    99 -LSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLC 162
             .:.|.|::...:                 ||...:|....::...:..::||::|..|||||:.
Zfish    82 HRAILLSLEQRAS-----------------PRIFATHFHHQMMNPSYFKIEPRVLYVMRNPKDVF 129

  Fly   163 VSYYHYFKLLHGM------NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMV 221
            :|.:||:    ||      .|..::|::.||.|:...||::.||..:...::.:::|:|.||:|:
Zfish   130 ISSFHYY----GMASFLVNPGTQDEFMEKFLNGNIMFGSWFDHVKGWLNAAEQEHILYISYEEMI 190

  Fly   222 KDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNGK 282
            .||.:.|.:.|.|||  ..|....::|:.||..|..|:.||..||    |:.:.:..|:|:|.|.
Zfish   191 NDLRASVEKIATFLG--KSLSSEVVEKIADHCVFKNMKQNKMSNLSLVPEEFMDQKKSEFLRKGI 253

  Fly   283 IGDWRNHMGNEMSERFDEWTERHMRGSGLNFDY 315
            .|||:||......|||:...:..|:.....|.:
Zfish   254 AGDWKNHFSAAQEERFNAVYDDKMKDVKFKFPW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 82/274 (30%)
sult2st2NP_001071637.1 Sulfotransfer_1 35..279 CDD:279075 82/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.