DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult2st3

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001071636.2 Gene:sult2st3 / 777792 ZFINID:ZDB-GENE-061117-4 Length:288 Species:Danio rerio


Alignment Length:294 Identity:90/294 - (30%)
Similarity:147/294 - (50%) Gaps:33/294 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FIIPRKYVELGESIRSL---PVYQDDVWMVSYPRTGSTWAQEMV--WLLGHQLDYVAAEQDLRLR 93
            |::| |.....||::.|   .|..|||:.|:||::|:||.|.::  .|.|..|..|....:.. |
Zfish    13 FLLP-KLAHTEESLQYLENFKVKDDDVFAVTYPKSGTTWMQNILPPLLNGGDLTPVQTVPNWD-R 75

  Fly    94 SP-LIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARN 157
            :| |.|:.|...::..                 |.||...||:|:.|:|..|...|.:::|.|||
Zfish    76 APWLEEIRAAVVLEER-----------------PSPRAIVSHMPYRLMPSSFYKSKAKVIYVARN 123

  Fly   158 PKDLCVSYYHYFKLLHGMN--GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDM 220
            |||:.||.||:.|:...:.  |.|:.||:.||.|....|.:..|:..:......|.:|::.||:|
Zfish   124 PKDVIVSSYHFHKMASFLEDPGTFDDFVNKFLSGEIVFGKWSDHIKSWRNPELKDRILYVTYEEM 188

  Fly   221 VKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNG 281
            ::||..|:.|..:|||.:  |....|.::..:.||..|:.||..|.    ::::..:.|.|:|.|
Zfish   189 LQDLRGVLCRMLKFLGRE--LSTEALDRVVSNSTFKNMKTNKMSNYTMVPQEIMDNNKSAFLRKG 251

  Fly   282 KIGDWRNHMGNEMSERFDEWTERHMRGSGLNFDY 315
            ..|||:|....|:..:|.......|:|:.:.|.:
Zfish   252 VAGDWKNFFSPELDAKFTAVIREEMKGTNIKFPW 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 82/263 (31%)
sult2st3NP_001071636.2 Sulfotransfer_1 35..279 CDD:279075 81/263 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.