DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult6b1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001157097.1 Gene:Sult6b1 / 73671 MGIID:1920921 Length:303 Species:Mus musculus


Alignment Length:288 Identity:83/288 - (28%)
Similarity:134/288 - (46%) Gaps:50/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQ---DDVWMVSYPRTGSTW----AQEMVWLLGHQLDYVAAEQDLRLRSPLIELSAL 102
            |:.|:|..::   |||.:.|||:.||.|    ..|:::.:..: .|...|      .|::|... 
Mouse    43 ETFRALDAFEARSDDVLLASYPKCGSNWILHIVSELIFAVSKK-KYACPE------FPVLECGD- 99

  Fly   103 FSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYH 167
                     |:|:    ..::..|.||...:||.:..||:.....|.:|:...|||||..||::|
Mouse   100 ---------AEKY----QRMKLFPSPRILTTHLHYDKLPQSIFKNKAKILVIFRNPKDTAVSFFH 151

  Fly   168 YFKLLHGMNGD------FEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPS 226
            :    |....|      :::|...|::|....|||:...:.:.|...|:||.||.|||:.::|..
Mouse   152 F----HNDVPDIPSYASWDEFFRQFIKGQVSWGSYFDFAINWNKHIDDENVKFILYEDLKENLVV 212

  Fly   227 VVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFI-RNGKIGDWR--- 287
            .:::.:.|||. ||.| ..::.:....||..||||.......:.|     |: |.|::|||:   
Mouse   213 GIKQISEFLGF-SLTD-EQIETISTQSTFLAMRANSQETHGAIGP-----FLFRKGEVGDWKRLF 270

  Fly   288 NHMGN-EMSERFDEWTERHMRGSGLNFD 314
            |...| ||.|||.|.......|..|.::
Mouse   271 NETQNQEMDERFKECLAGTSLGDKLKYE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 79/269 (29%)
Sult6b1NP_001157097.1 Sulfotransfer_1 56..289 CDD:279075 78/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.