DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult6b1.3

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001164990.1 Gene:sult6b1.3 / 734046 XenbaseID:XB-GENE-22063270 Length:301 Species:Xenopus tropicalis


Alignment Length:306 Identity:80/306 - (26%)
Similarity:152/306 - (49%) Gaps:50/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EVLPDQFIIP--RKYVELG--------------ESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWL 76
            ::|.|..::|  :|.::|.              :::.|....:||:.:||||:.|:||:      
 Frog    13 KLLDDSDMVPQDKKLIQLNGVLYPAALCSEENFKALESFEAREDDLMLVSYPKCGTTWS------ 71

  Fly    77 LGHQLDYVAAEQDLRLRSPLIELSALFSIDHHETV-AQKFG--NTVDLVRNLPRPRFARSHLPWP 138
                         |.|.:.:::  .:::.|....: ..:||  |..:.:...|.||...:||.:.
 Frog    72 -------------LNLLNDMVQ--TVYNKDPPNMIQILEFGAPNKYEKLNEEPSPRVLGTHLHYD 121

  Fly   139 LLPEQFETVKPRIVYTARNPKDLCVSYYHYFK---LLHGMNGDFEQFVDLFLEGHTPMGSYWRHV 200
            .:|:.|...|.:::...|||||..||::|::.   :|...: .::.|.:.|:.|....|||:.|.
 Frog   122 NIPQSFFNKKIKLLVVFRNPKDTAVSFFHFYNKNPMLPNYS-SWDTFFEDFIGGKVCWGSYFDHA 185

  Fly   201 LPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVN 265
            |.:.|...|::||.:.:|:|.:||.:.|::.::|.|. |:.| ..:|::....||..|: .|..|
 Frog   186 LAWNKHIDDEDVLLMTFEEMKEDLEAAVKKLSKFCGF-SMTD-EQVQEVAKKGTFTAMK-EKISN 247

  Fly   266 LEKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGL 311
            ::|   |.:..|:|.|::|||:||.....|:..|...|..:.|:.|
 Frog   248 IQK---EFADIFLRKGEVGDWKNHFSEAQSQEIDAKFEACLAGTKL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 73/260 (28%)
sult6b1.3NP_001164990.1 Sulfotransfer_1 55..288 CDD:366246 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.