DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult1e1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001037908.1 Gene:sult1e1 / 733517 XenbaseID:XB-GENE-5756033 Length:303 Species:Xenopus tropicalis


Alignment Length:283 Identity:82/283 - (28%)
Similarity:146/283 - (51%) Gaps:21/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KY-VELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSAL 102
            || ||..|.:.......|||.:.:||:.|:||..|:       :|.:.|..||.    ..:..|:
 Frog    30 KYNVENWERMDYFQARHDDVVIATYPKAGTTWVSEI-------MDMIYAGGDLE----KCQRDAI 83

  Fly   103 FS-IDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYY 166
            :: :.:.|.......:.||.:..|..||..::|:|..|:||.|.....:::|.|||.||:.|||:
 Frog    84 YNRVPYMEIRVPGMPSGVDQLEVLASPRLIKTHVPIHLMPESFWEKNCKVIYVARNAKDVAVSYF 148

  Fly   167 HYFKLLHGM--NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVR 229
            .:..::..:  .|.:::||..::.|....||::.||..:|:|.....:|::.|||:.:|....::
 Frog   149 FFHNMVKALPDPGPWDKFVTDYMNGAVSYGSWFDHVKGWWERRNQYQILYLFYEDLKEDPKREIK 213

  Fly   230 RCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLE----KLLPESSSKFIRNGKIGDWRNHM 290
            :...||  :..|....|:|:..|.:|..|..|...|.:    :||.::::.|:|.|:.|||:||.
 Frog   214 KILHFL--KRELSEEVLEKIVHHTSFQIMSKNTMANYKTIPNELLNQTNTAFMRKGEAGDWKNHF 276

  Fly   291 GNEMSERFDEWTERHMRGSGLNF 313
            ....:|.||...::.|.|:.|:|
 Frog   277 TVAQNEMFDTHYQKEMLGTSLHF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 75/261 (29%)
sult1e1NP_001037908.1 Sulfotransfer_1 47..295 CDD:366246 74/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4088
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9567
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.