DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult1c2

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_081211.3 Gene:Sult1c2 / 69083 MGIID:1916333 Length:296 Species:Mus musculus


Alignment Length:280 Identity:88/280 - (31%)
Similarity:147/280 - (52%) Gaps:20/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQD-LRLRSPLIELSALFS 104
            |:....|::.....||:.:.:||::|:||.||:|.::....|.....:. ::.|.|.||.:    
Mouse    26 VDNWRQIQTFEAKPDDLLICTYPKSGTTWIQEIVDMIEQNGDVEKCRRTIIQHRHPFIEWA---- 86

  Fly   105 IDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYF 169
                 ...|..|  ||....:|.||..|:|||..|||..|.|...:.:|.|||.||..|||||::
Mouse    87 -----RPPQPSG--VDKANEMPAPRILRTHLPTQLLPPSFWTNNCKFLYVARNAKDCMVSYYHFY 144

  Fly   170 KLLHGM--NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCA 232
            ::...:  .|.::::.:.|:.|....||::.||..:|:......:||:.||||.::....:::..
Mouse   145 RMSQVLPEPGTWDEYFETFINGKVSWGSWFDHVKGWWEIRDKYQILFLFYEDMKRNPKHEIQKVM 209

  Fly   233 RFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNGKIGDWRNHMGNE 293
            :|:|..  ||...:.|:....:|:||:.|...|.    :.:|.:|.|.|:|.|.:|||:||....
Mouse   210 QFMGKN--LDEDVVDKIVLETSFEKMKENPMTNRSTAPKSILDQSISPFMRKGTVGDWKNHFTVA 272

  Fly   294 MSERFDEWTERHMRGSGLNF 313
            .:|||||..::.|..:.|||
Mouse   273 QNERFDEIYKQKMGRTSLNF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 83/261 (32%)
Sult1c2NP_081211.3 Sulfotransfer_1 39..288 CDD:279075 83/261 (32%)
Substrate binding. /evidence=ECO:0000250 107..109 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4511
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4330
Isobase 1 0.950 - 0 Normalized mean entropy S5749
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - otm44260
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.