DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SULT2A1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_003158.2 Gene:SULT2A1 / 6822 HGNCID:11458 Length:285 Species:Homo sapiens


Alignment Length:309 Identity:77/309 - (24%)
Similarity:138/309 - (44%) Gaps:45/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEEDILRRTNAVFPVQNCFVEVL---PDQFIIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTW 69
            :.:|.|......||......|.|   .|:|:|                ..:||.:::||::|:.|
Human     1 MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVI----------------RDEDVIILTYPKSGTNW 49

  Fly    70 AQEMVWLLGHQLDYVAAEQDLRL--RSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFAR 132
            ..|::.|: |........|.:.:  |||.:|              .:.|.|.  :.....||...
Human    50 LAEILCLM-HSKGDAKWIQSVPIWERSPWVE--------------SEIGYTA--LSETESPRLFS 97

  Fly   133 SHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMN--GDFEQFVDLFLEGHTPMGS 195
            ||||..|.|:.|.:.|.:::|..|||:|:.||.|.::|.:..:.  ..:|::.:.|.:|....||
Human    98 SHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGS 162

  Fly   196 YWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRA 260
            ::.|:..:....::.|.|.:.||::.:|....:.:..:|||  ..|:...|..:..:.:|..|:.
Human   163 WFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLG--KTLEPEELNLILKNSSFQSMKE 225

  Fly   261 NKAVNLEKLLPE---SSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHM 306
            ||..|...|..:   ..::.:|.|..|||:||.....:|.||:..:..|
Human   226 NKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 68/259 (26%)
SULT2A1NP_003158.2 Sulfotransfer_1 34..278 CDD:395556 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4541
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4329
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.