DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SULT2B1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_814444.1 Gene:SULT2B1 / 6820 HGNCID:11459 Length:365 Species:Homo sapiens


Alignment Length:317 Identity:99/317 - (31%)
Similarity:149/317 - (47%) Gaps:48/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IYRELEEDILRRTNAVFPVQNCFVEVLPDQFIIPRKYVELGESIRSLPVYQDDVWMVSYPRTGST 68
            |.::|..:..|.....|||.           :...:.:.|.|:.:.  |..||:::::||::|:|
Human    23 ISQKLPGEYFRYKGVPFPVG-----------LYSLESISLAENTQD--VRDDDIFIITYPKSGTT 74

  Fly    69 WAQEMVWLLGHQLDYVAAEQDLR-LRS-PLIELSALFSIDHHETVAQKFGNTVDLVRNLP---RP 128
            |..|::.|       :..|.|.. :|| |:.|.:...     ||:...|        :||   .|
Human    75 WMIEIICL-------ILKEGDPSWIRSVPIWERAPWC-----ETIVGAF--------SLPDQYSP 119

  Fly   129 RFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMN--GDFEQFVDLFLEGHT 191
            |...||||..:..:.|.:.|.:::|..|||:|:.||.|||.|:...:.  |..:||:..||:|..
Human   120 RLMSSHLPIQIFTKAFFSSKAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEV 184

  Fly   192 PMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFD 256
            ..||::.|:..:.:....||.|||.||::.:||...|.|...|||  ..|....|..:..|.||.
Human   185 QFGSWFDHIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLG--RPLGKEALGSVVAHSTFS 247

  Fly   257 KMRANKAVNLEKLLPES-----SSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRG 308
            .|:||...|. .|||.|     ...|:|.|..|||:||.....||.||....:.|||
Human   248 AMKANTMSNY-TLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQMRG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 90/266 (34%)
SULT2B1NP_814444.1 Sulfotransfer_1 60..305 CDD:366246 90/267 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..365 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.