DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SULT1C2

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_789795.1 Gene:SULT1C2 / 6819 HGNCID:11456 Length:307 Species:Homo sapiens


Alignment Length:287 Identity:90/287 - (31%)
Similarity:147/287 - (51%) Gaps:23/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQD-LRLRSPLIELS---- 100
            |:....|:|.....||:.:.:||:.|:||.||:|.::....|....::. ::.|.|.||.:    
Human    26 VDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQ 90

  Fly   101 ---ALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLC 162
               ..|   ||  |||  .....|..:.|....::|.....|||..|.....:.:|.|||.||..
Human    91 PSETGF---HH--VAQ--AGLKLLSSSNPPASTSQSAKITDLLPPSFWENNCKFLYVARNAKDCM 148

  Fly   163 VSYYHYFKLLHGM--NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLP 225
            |||||:.::.|.:  .|.:|::.:.|:.|....||::.||..:|:......:||:.|||:.:|..
Human   149 VSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPK 213

  Fly   226 SVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVN----LEKLLPESSSKFIRNGKIGDW 286
            ..:|:..:|:|.:  :|.:.|.|:....:|:||:.|...|    .:.:|.:|.|.|:|.|.:|||
Human   214 HEIRKVMQFMGKK--VDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDW 276

  Fly   287 RNHMGNEMSERFDEWTERHMRGSGLNF 313
            :||.....:|||||...|.|.|:.:||
Human   277 KNHFTVAQNERFDEIYRRKMEGTSINF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 85/268 (32%)
SULT1C2NP_789795.1 Sulfotransfer_1 39..299 CDD:279075 84/268 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4541
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4329
Isobase 1 0.950 - 0 Normalized mean entropy S5749
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8578
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.