DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SULT1A3

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_808220.1 Gene:SULT1A3 / 6818 HGNCID:11455 Length:295 Species:Homo sapiens


Alignment Length:311 Identity:92/311 - (29%)
Similarity:160/311 - (51%) Gaps:44/311 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VEVLPDQFIIPRKYVE-------LGESIRSLPVYQ---DDVWMVSYPRTGSTWAQEMVWLLGHQL 81
            :|::.|....|.:||:       ..|::..|..:|   ||:.:.:||::|:||..::       |
Human     1 MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQI-------L 58

  Fly    82 DYVAAEQDLR--------LRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWP 138
            |.:....||.        :|.|.:|::     |..|.      :.::.:::.|.||..:||||..
Human    59 DMIYQGGDLEKCNRAPIYVRVPFLEVN-----DPGEP------SGLETLKDTPPPRLIKSHLPLA 112

  Fly   139 LLPEQFETVKPRIVYTARNPKDLCVSYYHYFKL--LHGMNGDFEQFVDLFLEGHTPMGSYWRHVL 201
            |||:.....|.::||.||||||:.|||||:.::  .|...|.::.|::.|:.|....||:::||.
Human   113 LLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQ 177

  Fly   202 PFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNL 266
            .:|:.|:...||::.||||.::....:::...|:| :||.: .|:..:..|.:|.:|:.|...|.
Human   178 EWWELSRTHPVLYLFYEDMKENPKREIQKILEFVG-RSLPE-ETMDFMVQHTSFKEMKKNPMTNY 240

  Fly   267 ----EKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNF 313
                ::|:..|.|.|:|.|..|||:.......:||||......|.|..|:|
Human   241 TTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 82/268 (31%)
SULT1A3NP_808220.1 Sulfotransfer_1 38..287 CDD:395556 81/268 (30%)
Substrate binding 106..108 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8578
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.