DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SULT1A2

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001045.2 Gene:SULT1A2 / 6799 HGNCID:11454 Length:295 Species:Homo sapiens


Alignment Length:311 Identity:88/311 - (28%)
Similarity:156/311 - (50%) Gaps:44/311 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VEVLPDQFIIPRKYVE-------LGESIRSLPVYQ---DDVWMVSYPRTGSTWAQEMVWLLGHQL 81
            :|::.|....|.:||:       ..|::..|..:|   ||:.:.:||::|:||..::       |
Human     1 MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQI-------L 58

  Fly    82 DYVAAEQDLR--------LRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWP 138
            |.:....||.        :|.|.:|..           .....:.::.::|.|.||..::|||..
Human    59 DMIYQGGDLEKCHRAPIFMRVPFLEFK-----------VPGIPSGMETLKNTPAPRLLKTHLPLA 112

  Fly   139 LLPEQFETVKPRIVYTARNPKDLCVSYYHYFKL--LHGMNGDFEQFVDLFLEGHTPMGSYWRHVL 201
            |||:.....|.::||.|||.||:.|||||::.:  ::...|.:|.|::.|:.|....||:::||.
Human   113 LLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQ 177

  Fly   202 PFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNL 266
            .:|:.|:...||::.||||.::....:::...|:| :||.: .|:..:.:|.:|.:|:.|...|.
Human   178 EWWELSRTHPVLYLFYEDMKENPKREIQKILEFVG-RSLPE-ETVDLMVEHTSFKEMKKNPMTNY 240

  Fly   267 ----EKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNF 313
                .:.:..|.|.|:|.|..|||:.......:||||....:.|.|..|:|
Human   241 TTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 78/268 (29%)
SULT1A2NP_001045.2 Sulfotransfer_1 38..287 CDD:395556 77/268 (29%)
Substrate binding. /evidence=ECO:0000250 106..108 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8578
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.