DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult4a1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001035334.1 Gene:sult4a1 / 678517 ZFINID:ZDB-GENE-060421-2705 Length:284 Species:Danio rerio


Alignment Length:285 Identity:94/285 - (32%)
Similarity:147/285 - (51%) Gaps:50/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHE 109
            :.|.:..:...|:|:|:||::|::..||:|:|:..     .|:.|        |: .|.:||...
Zfish    36 DEIANFSLRSSDIWIVTYPKSGTSLLQEVVYLVSQ-----GADPD--------EI-GLMNIDEQL 86

  Fly   110 TVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHG 174
            .|.:.....:::::.|..||..:||||:..||......:.:::|.|||||||.||||.:.:.|..
Zfish    87 PVLEYPQPGLEIIQELTSPRLIKSHLPYRFLPSAMHNGEGKVIYMARNPKDLVVSYYQFHRSLRT 151

  Fly   175 MN--GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGV 237
            |:  |.|::|...|:......||::.||..||:...|.||||:|||||.|||.::|.:.||||||
Zfish   152 MSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMYKDLGTLVEQLARFLGV 216

  Fly   238 QSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIR-----------NGKIGDWRNHMG 291
            .           ||          || .||.|: |||::.|.           .|::|.|::...
Zfish   217 S-----------CD----------KA-QLESLV-ESSNQLIEQCCNSEALSICRGRVGLWKDVFT 258

  Fly   292 NEMSERFDEWTERHMRGSGLNFDYV 316
            ..|:|:||....:.|..|.|.||::
Zfish   259 VSMNEKFDVIYRQKMAKSDLTFDFI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 89/267 (33%)
sult4a1NP_001035334.1 Sulfotransfer_1 47..277 CDD:279075 89/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I4344
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.