DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SULT1E1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_005411.1 Gene:SULT1E1 / 6783 HGNCID:11377 Length:294 Species:Homo sapiens


Alignment Length:286 Identity:83/286 - (29%)
Similarity:155/286 - (54%) Gaps:26/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRL-RSPLIELSA 101
            :.:|:..:::.:.....||:.:.:||::|:||..|:|:::..:.|....::|:.. |.|.:|.. 
Human    21 KDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECR- 84

  Fly   102 LFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYY 166
                      .:...|.|..:..:..||..::|||..|||..|.....:|:|..||.||:.||:|
Human    85 ----------KENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFY 139

  Fly   167 HYFKLL--HGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVR 229
            ::|.::  |...|.|.:||:.|::|..|.||:::||..:|::.:...|||:.|||:.:|:...|.
Human   140 YFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVI 204

  Fly   230 RCARFL---GVQSLLDVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNGKIGDWR 287
            :...||   ..:.|:|     ::..|.:|.:|:.|.:.|.    ::::.:..|.|:|.|..|||:
Human   205 KLIHFLERKPSEELVD-----RIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWK 264

  Fly   288 NHMGNEMSERFDEWTERHMRGSGLNF 313
            ||....::|:||:..|:.|:.|.|.|
Human   265 NHFTVALNEKFDKHYEQQMKESTLKF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 79/264 (30%)
SULT1E1NP_005411.1 Sulfotransfer_1 37..287 CDD:395556 79/265 (30%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P49891 105..107 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4541
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8578
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.