DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult1b1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_071958.1 Gene:Sult1b1 / 64305 RGDID:708534 Length:299 Species:Rattus norvegicus


Alignment Length:319 Identity:94/319 - (29%)
Similarity:170/319 - (53%) Gaps:46/319 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EDILRRTNAV---FPVQNCFVEVLPDQFIIPRKYVELG----ESIRSLPVYQDDVWMVSYPRTGS 67
            ||:.|:...:   :|:...|.               ||    |..:|.|.   |:.:.:||::|:
  Rat     5 EDVFRKDLKIIHGYPMVYAFA---------------LGWEKIEEFQSRPC---DIVIPTYPKSGT 51

  Fly    68 TWAQEMVWLLGHQLDYVAAEQD-LRLRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFA 131
            ||..|:|.::.:..:....::| :..:.|::|        .:...|::.|  |:|::..|.||..
  Rat    52 TWLSEIVDMVLNDGNVGKCKRDVITSKVPMLE--------QNVPGARRSG--VELLKKTPSPRII 106

  Fly   132 RSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMN---GDFEQFVDLFLEGHTPM 193
            ::|||..|||:.|...|.:::|.|||.||:.||||| |.|::.:.   |.:|::::.||.|:...
  Rat   107 KTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYH-FDLMNNIQPLPGTWEEYLEKFLAGNVAY 170

  Fly   194 GSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKM 258
            ||::.||..:|::.:...:||:.|||:.|:....:::.|.||  ...||..||:::..|.:|:.|
  Rat   171 GSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFL--DKTLDEHTLERIVHHTSFEVM 233

  Fly   259 RANKAVNL----EKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNF 313
            :.|..||.    .:::..|.|.|:|.|.:|||:|:.....||:||...::.:.|:.|.|
  Rat   234 KDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 82/262 (31%)
Sult1b1NP_071958.1 Sulfotransfer_1 40..289 CDD:279075 82/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9151
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.