DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult2a6

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001074794.1 Gene:Sult2a6 / 629219 MGIID:3648915 Length:285 Species:Mus musculus


Alignment Length:292 Identity:83/292 - (28%)
Similarity:141/292 - (48%) Gaps:41/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LPDQFIIPRKYVELGESIRSLPVYQD-DVWMVSYPRTGSTWAQEMVWLLGHQLD--YVAAEQDLR 91
            |||.::    ..|:.|.:.:..|.:| |:.:::||::|:.|..|:|.|:..:.|  ::.:..:..
Mouse    13 LPDMWV----QKEIVEDVHNKFVVKDEDLIILTYPKSGTNWLIEIVCLIQTKGDPKWIQSVPNWE 73

  Fly    92 LRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTAR 156
             |||.:|..:.:|:     :..|.|           ||...||||..|..:.|.:.|.:::|..|
Mouse    74 -RSPWLESKSGYSV-----LTSKEG-----------PRLMTSHLPIHLFSKSFFSSKAKVIYLIR 121

  Fly   157 NPKDLCVSYYHYF------KLLHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFI 215
            ||:|:.||.|.::      |.|..:...|||    ||:|:...||::.|:..:....:.:|.|.:
Mouse   122 NPRDVLVSGYFFWANTNLVKNLESLGIYFEQ----FLKGNVRYGSWFEHIHGWLSMRERNNFLVL 182

  Fly   216 KYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPE----SSSK 276
            .||||.||....:::...|||..  |....|..:..:.:|..|:.|...|. .|:.|    :..|
Mouse   183 YYEDMKKDAKGTIKKICDFLGKN--LGPDELDLVLKYSSFQAMKENNMSNY-SLIKEDQITNGLK 244

  Fly   277 FIRNGKIGDWRNHMGNEMSERFDEWTERHMRG 308
            .:|.|..|||:||.....:|.||:..:..|.|
Mouse   245 LMRKGTTGDWKNHFTVAQTEAFDKVFQDKMVG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 77/267 (29%)
Sult2a6NP_001074794.1 Sulfotransfer_1 34..278 CDD:279075 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4511
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.