DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult3st4

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001295759.1 Gene:sult3st4 / 619243 ZFINID:ZDB-GENE-050913-17 Length:299 Species:Danio rerio


Alignment Length:293 Identity:88/293 - (30%)
Similarity:151/293 - (51%) Gaps:30/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VEVLPDQFIIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLR 91
            |..|...:.|..:|:   :||:......|||::|::|::|:.|.|.::.|:        .|:|..
Zfish    20 VLTLEPSYDITPEYI---DSIQDFETRDDDVFVVTFPKSGTVWTQRIITLI--------YEEDFP 73

  Fly    92 LRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTAR 156
            .::..|....:..|::     :|.|....   ..|.||...|||..||:|:..:. |.:::|..|
Zfish    74 EKAKQITFEQMPWIEY-----RKKGKDYS---TRPSPRLFCSHLLEPLMPKTLKR-KGKVIYVMR 129

  Fly   157 NPKDLCVSYYHYFKLLHGMNG--DFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDD-NVLFIKYE 218
            ||||:.|||:|:.|.:..::.  .:::.::.||.|....||::.|| ..|..|:|. |:|.:.||
Zfish   130 NPKDVMVSYFHFSKKMKNLDSAKSYDEVLENFLTGCMVGGSWFDHV-KGWVTSKDKYNILILTYE 193

  Fly   219 DMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKL----LPESSSKFIR 279
            :|:|||.||:.:...|:| ::|.| :.:.|:.:..||.:|:.:...|.|.|    ..:....|:|
Zfish   194 EMIKDLRSVIVKICEFVG-KNLSD-AAIDKVVERATFKQMKVDPVANYESLPVDITDQPKGAFMR 256

  Fly   280 NGKIGDWRNHMGNEMSERFDEWTERHMRGSGLN 312
            .|.:|||||.:....||..|...|..|:...||
Zfish   257 KGTVGDWRNSLTMAQSECVDGALEERMKDVPLN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 80/261 (31%)
sult3st4NP_001295759.1 Sulfotransfer_1 44..287 CDD:279075 80/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.