DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult1st5

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001186832.1 Gene:sult1st5 / 619193 ZFINID:ZDB-GENE-050809-2 Length:293 Species:Danio rerio


Alignment Length:281 Identity:84/281 - (29%)
Similarity:146/281 - (51%) Gaps:27/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQ-DLRLRSPLIELS 100
            |.:.|:....:......::|:.:.:||::|:||.||:|.|:.:..|....:: ..::|.|.:|: 
Zfish    18 PERIVKYWTRVEQFQASEEDLLIATYPKSGTTWIQEVVDLILNDGDVDKCKRAPTQVRMPFLEM- 81

  Fly   101 ALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSY 165
                     |.|......:..:..:..||..::|||..|||..||....:::|.||||||..||:
Zfish    82 ---------TAADGSNAGITKLETMDPPRVIKTHLPIQLLPRSFENAGCKVIYVARNPKDSVVSF 137

  Fly   166 YHYFKLLHGMN------GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDL 224
            ||:.:    ||      |.::|:::.|::|....||::.||..:|:......:.::.:|||.:|.
Zfish   138 YHFDR----MNLRQPEPGPWKQYLERFMKGQLVWGSWFDHVKGYWRERHKRKIHYMFFEDMKEDP 198

  Fly   225 PSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNGKIGD 285
            ...|.|.|:|||.|  |..||:..:....||..||.|...|.    :.:...::|:|:|.|::||
Zfish   199 AREVTRTAQFLGRQ--LSESTIDHIVQMTTFSVMRENPMANYSTLPDTIFDRTASQFMRKGEVGD 261

  Fly   286 WRNHMGNEMSERFDEWTERHM 306
            |:||...|.:..|||..::.|
Zfish   262 WKNHFSAEENAAFDEHYQKKM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 82/263 (31%)
sult1st5NP_001186832.1 Sulfotransfer_1 35..286 CDD:279075 82/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.