DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult4a1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_113829.1 Gene:Sult4a1 / 58953 RGDID:69292 Length:284 Species:Rattus norvegicus


Alignment Length:273 Identity:94/273 - (34%)
Similarity:145/273 - (53%) Gaps:28/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHE 109
            |.|...||...|||:|:||::|::..||:|:|:..     .|:.|        |: .|.:||...
  Rat    36 EDIADFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQ-----GADPD--------EI-GLMNIDEQL 86

  Fly   110 TVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHG 174
            .|.:.....:|:::.|..||..:||||:..||........:::|.|||||||.||||.:.:.|..
  Rat    87 PVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRT 151

  Fly   175 MN--GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGV 237
            |:  |.|::|...|:......||::.||..||:...|.||||:|||||.:||.::|.:.||||||
  Rat   152 MSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDANVLFLKYEDMHRDLVTMVEQLARFLGV 216

  Fly   238 QSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWT 302
            .  .|.:.|:.|.:|.   ....::..|.| .||      :..|::|.|::.....|:|:||...
  Rat   217 S--CDKAQLESLIEHC---HQLVDQCCNAE-ALP------VGRGRVGLWKDIFTVSMNEKFDLVY 269

  Fly   303 ERHMRGSGLNFDY 315
            ::.|....|.||:
  Rat   270 KQKMGKCDLTFDF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 87/256 (34%)
Sult4a1NP_113829.1 Sulfotransfer_1 45..277 CDD:395556 87/257 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9151
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.