DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult3a1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_065590.2 Gene:Sult3a1 / 57430 MGIID:1931469 Length:293 Species:Mus musculus


Alignment Length:293 Identity:87/293 - (29%)
Similarity:152/293 - (51%) Gaps:49/293 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLL---GHQ--------LDYVAAEQDLRLRS 94
            :|:.|:|.:..:..||:::|:||::|:.|.|:::.|:   ||:        :|          |:
Mouse    23 MEVVENIENYEIRDDDIFIVTYPKSGTIWTQQILSLIYFEGHRNRTENIETID----------RA 77

  Fly    95 PLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPK 159
            |..|.: :..:|:               ..:|.||...||:|:.|:|:..:..|.:|:|..||||
Mouse    78 PFFEYN-IHKLDY---------------AKMPSPRIFSSHIPYYLVPKGLKDKKAKILYIYRNPK 126

  Fly   160 DLCVSYYHYFKL-LHGMNGD-FEQFVDLFLEGHTPMGSYW-RHVLPFWKRSQDDNVLFIKYEDMV 221
            |:.:||:|:..| |...|.| .|.|:..||:|.. :||.| .|:..:::...|.|::|:.:|||.
Mouse   127 DVLISYFHFSNLMLIFQNPDTVESFMQTFLDGDV-VGSLWFDHIRGWYEHRHDFNIMFMSFEDMK 190

  Fly   222 KDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPE------SSSKFIRN 280
            |||.|.|.:...||  :..|....:..:....||.||:|:...|.|.::.:      ....|:|.
Mouse   191 KDLRSSVLKICSFL--EKELSEEDVDAVVRQATFQKMKADPRANYEHIIKDELGTRNEMGSFLRK 253

  Fly   281 GKIGDWRNHMGNEMSERFDEWTERHMRGSGLNF 313
            |.:|||::::..:.|||||:...|:|:...|.|
Mouse   254 GVVGDWKHYLTVDQSERFDKIFHRNMKNIPLKF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 82/274 (30%)
Sult3a1NP_065590.2 Sulfotransfer_1 36..280 CDD:366246 81/272 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.