DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult3st3

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001076345.1 Gene:sult3st3 / 571461 ZFINID:ZDB-GENE-060503-628 Length:299 Species:Danio rerio


Alignment Length:313 Identity:90/313 - (28%)
Similarity:160/313 - (51%) Gaps:40/313 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEEDILRRTNAVFPVQNCFVEVLPDQFIIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQE 72
            :.:.:|:....|..|.:       :|.|.| :|:   :||:......|||::|::|::|:.|.|.
Zfish     9 ISDKLLKYKGTVLTVND-------NQDITP-EYI---DSIQDFETRDDDVFVVTFPKSGTVWTQR 62

  Fly    73 MVWLLGHQLDY-VAAEQDLRLRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLP 136
            ::.|: ::.|: ..|:|....:.|.||..     |..:..:.:           |.||...|||.
Zfish    63 IMTLI-YEEDFPEKAKQITYEQMPWIEYR-----DKGKDYSTR-----------PSPRLFCSHLL 110

  Fly   137 WPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMNG--DFEQFVDLFLEGHTPMGSYWRH 199
            .||:|...:. |.:::|..|||||:.|||:|:...|..::.  .:::.:..|:.|....|.::.|
Zfish   111 EPLMPRALQR-KGKVIYVMRNPKDVMVSYFHFSNKLDNLDSSESYDEMLKKFITGCMVGGCWFDH 174

  Fly   200 VLPFWKRSQDD-NVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKA 263
            | ..|..|:|. |:|.:.||:|:|||.||:.:..:|:| ::|.| :.:.|:.:..||.:|:.:..
Zfish   175 V-KGWVTSKDKYNILILTYEEMIKDLRSVIVKICKFVG-KNLSD-AAIDKVVERTTFKQMKVDPV 236

  Fly   264 VNLEKLLPESSSK----FIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLN 312
            .|.|.|..|.:.:    |:|.|.:|||:|.:....||..|...|..|:...||
Zfish   237 ANYESLSKEITDQPKGAFLRKGTVGDWKNSLTVAQSECVDRVLEDRMKDVPLN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 79/262 (30%)
sult3st3NP_001076345.1 Sulfotransfer_1 44..287 CDD:279075 79/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.