DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult1b1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001343872.1 Gene:Sult1b1 / 56362 MGIID:2136282 Length:299 Species:Mus musculus


Alignment Length:277 Identity:86/277 - (31%)
Similarity:156/277 - (56%) Gaps:24/277 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQD-LRLRSPLIELSALFSIDHH 108
            |..:|.|   .|:.:.:||::|:||..|:|.::.:..:....::| :..:.|::|||        
Mouse    32 EEFQSTP---GDIVITTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLELS-------- 85

  Fly   109 ETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLH 173
              |.....:.|:|::..|.||..::|||..|||:.|...|.:::|.|||.||:.||||| |.|::
Mouse    86 --VPGIRISGVELLKKTPSPRIIKTHLPIDLLPKSFWENKCKMIYLARNGKDVAVSYYH-FDLMN 147

  Fly   174 GMN---GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFL 235
            .:|   |.:|::::.||.|:...||::.||..:|::.::..:|::.||::.::....:::.|.||
Mouse   148 SINPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREEHPLLYLYYEELKQNPKKEIKKIASFL 212

  Fly   236 GVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKL----LPESSSKFIRNGKIGDWRNHMGNEMSE 296
              ...||...|.::..|.:|:.|:.|..||...|    :..|.|.|:|.|.:|||:|:.....:|
Mouse   213 --DKTLDEEALDRIVHHTSFEMMKENPLVNYTHLPTAMMDHSKSPFMRKGIVGDWKNYFTMTQTE 275

  Fly   297 RFDEWTERHMRGSGLNF 313
            :||...::.|.|:.|.|
Mouse   276 QFDAVYKKKMSGTTLEF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 81/262 (31%)
Sult1b1NP_001343872.1 Sulfotransfer_1 38..289 CDD:395556 82/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4511
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - otm44260
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.