DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult3st1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_687148.1 Gene:sult3st1 / 558790 ZFINID:ZDB-GENE-061207-52 Length:293 Species:Danio rerio


Alignment Length:291 Identity:81/291 - (27%)
Similarity:135/291 - (46%) Gaps:57/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQ-----------------LDYVAAEQDLRL 92
            :|::...:...||::|:||::|:.|.|.::.|:...                 |:|.....|..|
Zfish    27 DSLQHFEIRDSDVFLVTYPKSGTIWVQNIINLVCEDSLTEKTKYPNNLEQMPWLEYREGRADYSL 91

  Fly    93 RSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARN 157
            |                                |.||...:||...|:|:..:..|.:|:|..||
Zfish    92 R--------------------------------PSPRLFATHLIPRLMPQGLKNKKGKIIYVRRN 124

  Fly   158 PKDLCVSYYHYFKLLHGMN--GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDM 220
            |||..|||:|:..:...:.  ..||.|:..:|.|:....|::.||..::|..::.::||:.||||
Zfish   125 PKDNAVSYFHFSHVWAKVETPKSFEDFLQQYLAGNVGGSSWFDHVKEWYKEKENYDILFLSYEDM 189

  Fly   221 VKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPES---SSKFIRNGK 282
            :.||.:.|.:.:||||..  ||.:.:.::.:..||..|:.:...|.| .||.:   ..:|:|.|.
Zfish   190 IIDLRTAVEKVSRFLGKN--LDAAAVARIVEKATFKNMKQDPKANYE-FLPNTVLLKPQFLRKGT 251

  Fly   283 IGDWRNHMGNEMSERFDEWTERHMRGSGLNF 313
            :|||:|......||.||:..|..|:...|||
Zfish   252 VGDWKNTFTVSQSEMFDQIFEERMKNVPLNF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 77/276 (28%)
sult3st1XP_687148.1 Sulfotransfer_1 36..276 CDD:279075 76/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.