DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult2b1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001347713.1 Gene:Sult2b1 / 54200 MGIID:1926342 Length:372 Species:Mus musculus


Alignment Length:266 Identity:88/266 - (33%)
Similarity:132/266 - (49%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VYQDDVWMVSYPRTGSTWAQEMVWLLGHQLD--YVAAEQDLRLRSPLIELSALFSIDHHETVAQK 114
            |..||:::|:||::|:.|..|:|.|:....|  ::.:| .:..|:|..           ||:...
Mouse    89 VRDDDIFIVTYPKSGTNWMIEIVCLILKDGDPSWIRSE-PIWQRAPWC-----------ETIISA 141

  Fly   115 FGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMN--G 177
            | |.:|    .|.||...||||..|..:.|.:.|.:::|..|||:|:.||.|:|.|:...:.  |
Mouse   142 F-NVLD----RPSPRIMSSHLPIELFTKAFFSSKAKVIYVGRNPRDVVVSLYYYSKIAGQLKDPG 201

  Fly   178 DFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLD 242
            ..:||:..||:|....||::.|:..:.:....:|.|||.||::.:||...|:|...|||  ..|.
Mouse   202 TPDQFLQNFLKGEVQFGSWFDHIKGWIRMQNQENFLFITYEELQQDLRGSVQRICEFLG--RPLG 264

  Fly   243 VSTLQKLCDHLTFDKMRANKAVNLEKLLPES-----SSKFIRNGKIGDWRNHMGNEMSERFDEWT 302
            ...|..:..|..|..|:||...|. .|||.|     ..:|:|.|..|||:||.....||.||...
Mouse   265 EEALSSVVAHSAFAAMKANTMSNY-SLLPASLLDHRQGEFLRKGISGDWKNHFTVAQSEAFDSVY 328

  Fly   303 ERHMRG 308
            ...|.|
Mouse   329 REQMHG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 87/263 (33%)
Sult2b1NP_001347713.1 Sulfotransfer_1 91..334 CDD:366246 86/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4511
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.