DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult1c2

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001004900.1 Gene:sult1c2 / 448251 XenbaseID:XB-GENE-6041310 Length:304 Species:Xenopus tropicalis


Alignment Length:273 Identity:94/273 - (34%)
Similarity:139/273 - (50%) Gaps:29/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLR--LRSPLIELSALFSIDHH---ETVA 112
            :.:||.:.|||:.|.||.||:|       |.:..|.|..  ||:|        :.|.|   |.|.
 Frog    45 HPEDVLLASYPKAGITWMQEVV-------DMIYQEGDTNKCLRAP--------TYDRHPFLEAVP 94

  Fly   113 QK-FGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGM- 175
            .| ..:.:.|...:..||..::|||..|:|..|.....:::|.|||.||..|||:|:.::..|: 
 Frog    95 PKPVPSGLQLAEEMEPPRVLKTHLPIQLIPPSFWKQNCKVIYVARNAKDSLVSYFHFQRMTKGLP 159

  Fly   176 -NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQS 239
             .|.::.:...||.|..|.||::.||..:||......||::.||||.|||...::|...||... 
 Frog   160 DPGTWDDYFMAFLSGTLPWGSWFDHVNGWWKAKDKHRVLYVFYEDMKKDLRLEIQRVESFLDKD- 223

  Fly   240 LLDVSTLQKLCDHLTFDKMRANKAVNLEKL----LPESSSKFIRNGKIGDWRNHMGNEMSERFDE 300
             |....|:|:|.|.||..|:.|...|...:    :.:|.|.|:|.|.:|||:||.....:|.||.
 Frog   224 -LPEEVLEKICQHTTFQAMKENPMANYTTMPTTVMDQSVSPFMRKGIVGDWKNHFLVAQNELFDW 287

  Fly   301 WTERHMRGSGLNF 313
            ..:|.|.|:||:|
 Frog   288 EYKRRMDGTGLDF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 91/266 (34%)
sult1c2NP_001004900.1 Sulfotransfer_1 46..297 CDD:307022 91/267 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.