DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SULT1A4

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001017390.1 Gene:SULT1A4 / 445329 HGNCID:30004 Length:295 Species:Homo sapiens


Alignment Length:311 Identity:92/311 - (29%)
Similarity:160/311 - (51%) Gaps:44/311 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VEVLPDQFIIPRKYVE-------LGESIRSLPVYQ---DDVWMVSYPRTGSTWAQEMVWLLGHQL 81
            :|::.|....|.:||:       ..|::..|..:|   ||:.:.:||::|:||..::       |
Human     1 MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQI-------L 58

  Fly    82 DYVAAEQDLR--------LRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWP 138
            |.:....||.        :|.|.:|::     |..|.      :.::.:::.|.||..:||||..
Human    59 DMIYQGGDLEKCNRAPIYVRVPFLEVN-----DPGEP------SGLETLKDTPPPRLIKSHLPLA 112

  Fly   139 LLPEQFETVKPRIVYTARNPKDLCVSYYHYFKL--LHGMNGDFEQFVDLFLEGHTPMGSYWRHVL 201
            |||:.....|.::||.||||||:.|||||:.::  .|...|.::.|::.|:.|....||:::||.
Human   113 LLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQ 177

  Fly   202 PFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNL 266
            .:|:.|:...||::.||||.::....:::...|:| :||.: .|:..:..|.:|.:|:.|...|.
Human   178 EWWELSRTHPVLYLFYEDMKENPKREIQKILEFVG-RSLPE-ETMDFMVQHTSFKEMKKNPMTNY 240

  Fly   267 ----EKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNF 313
                ::|:..|.|.|:|.|..|||:.......:||||......|.|..|:|
Human   241 TTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 82/268 (31%)
SULT1A4NP_001017390.1 Sulfotransfer_1 38..287 CDD:395556 81/268 (30%)
Substrate binding 106..108 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8578
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.