DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SULT1C3

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_016859642.1 Gene:SULT1C3 / 442038 HGNCID:33543 Length:349 Species:Homo sapiens


Alignment Length:283 Identity:84/283 - (29%)
Similarity:138/283 - (48%) Gaps:27/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSID 106
            |..|.:.:.....||:.:.:||::|:||..|:       ||.:..:.|:.      :.....::|
Human    79 EWWEKVCNFQAKPDDLILATYPKSGTTWMHEI-------LDMILNDGDVE------KCKRAQTLD 130

  Fly   107 HHETVAQKFGN----TVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYH 167
            .|..:..||.:    .::.|..:..|:..::|||..|:|........:|||.||||||..|||||
Human   131 RHAFLELKFPHKEKPDLEFVLEMSSPQLIKTHLPSHLIPPSIWKENCKIVYVARNPKDCLVSYYH 195

  Fly   168 YFKLLHGMNG--DFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRR 230
            :.::...|..  :.|:|.:.|:.|....||::.||..:|.......:|::.|||:.|:....:.:
Human   196 FHRMASFMPDPQNLEEFYEKFMSGKVVGGSWFDHVKGWWAAKDMHRILYLFYEDIKKNPKHEIHK 260

  Fly   231 CARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLP-----ESSSKFIRNGKIGDWRNHM 290
            ...||  :.......:.|:..|.:||.|:.|...| ...:|     .|.|||:|.|..|||:||.
Human   261 VLEFL--EKTWSGDVINKIVHHTSFDVMKDNPMAN-HTAVPAHIFNHSISKFMRKGMPGDWKNHF 322

  Fly   291 GNEMSERFDEWTERHMRGSGLNF 313
            ...::|.||:..|:.|.||.|||
Human   323 TVALNENFDKHYEKKMAGSTLNF 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 78/265 (29%)
SULT1C3XP_016859642.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8578
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.