DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult1a1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_988960.1 Gene:sult1a1 / 394557 XenbaseID:XB-GENE-970475 Length:287 Species:Xenopus tropicalis


Alignment Length:276 Identity:80/276 - (28%)
Similarity:147/276 - (53%) Gaps:20/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFS-IDHH 108
            |::.......||:.:.:||::|:||..|:|       |.:.|..:    |...:.:|::. :...
 Frog    23 ENVEKFQARPDDLLIATYPKSGTTWMSEIV-------DQIVAVSN----SERCKTAAIYERVPFL 76

  Fly   109 ETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFK--L 171
            |.......:....:.....||..::|||..|||:.|...|.:::|.|||.||:.|||||:::  :
 Frog    77 EYAVPDMPSGTQALDQRASPRLIKTHLPVELLPKSFWDNKVKVIYVARNAKDVAVSYYHFYRMAI 141

  Fly   172 LHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLG 236
            :|...|.:::|:|.::.|....||:..||..:|:::::.:||::.||||::|....:|:..:|:|
 Frog   142 VHPEPGTWDEFLDSYINGKVCFGSWSAHVKGWWQKAKEWDVLYLFYEDMLEDPTREIRKVVKFMG 206

  Fly   237 VQSLLDVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNGKIGDWRNHMGNEMSER 297
            ..  |...|::|:....:|..|:.|:..|.    ..::..|.|.|:|.|..|||:|......:|:
 Frog   207 KD--LPEETVEKIASQTSFKAMKQNELSNYSMVPSSVMDHSISPFMRKGVCGDWKNQFTVAQNEK 269

  Fly   298 FDEWTERHMRGSGLNF 313
            |||:.:|.|....|:|
 Frog   270 FDEYYQREMSDGALSF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 77/261 (30%)
sult1a1NP_988960.1 Sulfotransfer_1 32..280 CDD:395556 77/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4088
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9567
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.