DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SULT6B1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001354480.1 Gene:SULT6B1 / 391365 HGNCID:33433 Length:303 Species:Homo sapiens


Alignment Length:281 Identity:75/281 - (26%)
Similarity:130/281 - (46%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQ---DDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRL-RSPLIELSALFSI 105
            |:.::|..::   ||:.:.|||:.||.|...:|    .:|.|..:::..:. ..|::|...    
Human    43 ETFQALDTFEARHDDIVLASYPKCGSNWILHIV----SELIYAVSKKKYKYPEFPVLECGD---- 99

  Fly   106 DHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFK 170
                  ::|:    ..::..|.||...:||.:..||......|.:|:...|||||..||:.|:..
Human   100 ------SEKY----QRMKGFPSPRILATHLHYDKLPGSIFENKAKILVIFRNPKDTAVSFLHFHN 154

  Fly   171 LLHGM--NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCAR 233
            .:..:  .|.:::|...|::|....|.|:...:.:.|....|||.||.|||:.::|.:.:::.|.
Human   155 DVPDIPSYGSWDEFFRQFMKGQVSWGRYFDFAINWNKHLDGDNVKFILYEDLKENLAAGIKQIAE 219

  Fly   234 FLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFI-RNGKIGDWRN----HMGNE 293
            |||.  .|....:|.:....||..|||........:.|     |: |.|::|||:|    ....|
Human   220 FLGF--FLTGEQIQTISVQSTFQAMRAKSQDTHGAVGP-----FLFRKGEVGDWKNLFSEIQNQE 277

  Fly   294 MSERFDEWTERHMRGSGLNFD 314
            |.|:|.|.......|:.|.::
Human   278 MDEKFKECLAGTSLGAKLKYE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 72/262 (27%)
SULT6B1NP_001354480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.