DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and St3

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001261155.1 Gene:St3 / 37743 FlyBaseID:FBgn0265052 Length:526 Species:Drosophila melanogaster


Alignment Length:285 Identity:82/285 - (28%)
Similarity:139/285 - (48%) Gaps:34/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAA-EQDLRLRSPLIELSALFSIDHHET 110
            :..:.:..||||:|:.|:.|:||.||::|||.:..|:..| .:|..||:|.:|..  :|:.|...
  Fly    38 VHDMKLRDDDVWIVTLPKCGTTWMQELLWLLLNNCDFEGALAKDQELRTPFLEFG--YSVFHDPN 100

  Fly   111 VAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVS-YYH------- 167
              :.||.    :.:|..||..:|||...|||.:....|.:::|.:|||.|..|| |||       
  Fly   101 --RSFGP----IEDLKSPRLIKSHLSLALLPSKLWEGKNKVIYVSRNPLDSYVSRYYHGVSFGFN 159

  Fly   168 YFKLLHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCA 232
            |.|.||       |:.|..|........:..|...|::...:..|.:..:|.|.|||..|:...:
  Fly   160 YGKSLH-------QYFDEVLASDDFPTEFIEHAHEFYQLRNEPWVFYTSFEMMKKDLRGVINDVS 217

  Fly   233 RFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVN----LEKLLPESSSK----FIRNGKIGDWRNH 289
            |||  ...::...::||..||:|.:|:.|...|    |.::..|::.|    |:|.|.:..:::.
  Fly   218 RFL--NKPINDQQMEKLLKHLSFAEMKKNPTTNHLWELAQVQHENAGKEMHPFVRRGDVNGYKDE 280

  Fly   290 MGNEMSERFDEWTERHMRGSGLNFD 314
            :..|..|:.:...:..:..:|:..|
  Fly   281 LKPEQIEKANVRIQEVLAKNGVTLD 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 80/271 (30%)
St3NP_001261155.1 Sulfotransfer_1 45..301 CDD:279075 80/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100823at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44260
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11783
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
55.020

Return to query results.
Submit another query.