DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and St4

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001286398.1 Gene:St4 / 36548 FlyBaseID:FBgn0033887 Length:346 Species:Drosophila melanogaster


Alignment Length:339 Identity:97/339 - (28%)
Similarity:164/339 - (48%) Gaps:47/339 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RELEEDILRRTNA-----VFPVQNCFVEVLPDQFIIPRKYVELGESIRSLPVYQDDVWMVSYPRT 65
            |::||.    |||     ....:..||:|..:.:..|.||.:..|...:.....||||:.:.||:
  Fly    13 RDVEES----TNAELLDHFHGERTGFVQVGSEGYFFPHKYKDEAERYYNFEARPDDVWIATVPRS 73

  Fly    66 GSTWAQEMVWLLGHQLDYV-AAEQDLRLRSPLIELSALFSIDHHETVAQKF-------GNTVDLV 122
            |:||.||::||:.:.||:. |.|:.|..|.|..|    |.:..|..:.::.       ...::.:
  Fly    74 GTTWTQELIWLVANGLDFEHAQERPLTERFPFFE----FPLFVHPKIKEELQEENRDSAEALEFI 134

  Fly   123 RNLPRP-------------RFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLL-- 172
            ..:.||             ||.::|.|:.|:|......|.:::|..|:|||:.|||||..:|.  
  Fly   135 EKIARPGYEALSEIPRSQRRFIKTHFPFSLMPPSVLEKKCKVIYVVRDPKDVAVSYYHLNRLFRT 199

  Fly   173 HGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGV 237
            .|..||||::...|..|..|...|:.||....:.:...||||::||||:.|||..:...|.||  
  Fly   200 QGYVGDFERYWHYFQNGLNPWLPYYSHVKEAREHAHLSNVLFLRYEDMLADLPGAINSIASFL-- 262

  Fly   238 QSLLDVSTLQKLCDHLTFDKMRANKAVNLEKL-----LPESSSKFIRNGKIGDWRNHM----GNE 293
            :.......:.:|.|||:....|.||:||:.::     |.:..:.|:|:|....::...    ..:
  Fly   263 ECPPKPEDMDRLLDHLSIRSFRENKSVNMHEMASVGVLNKGEAGFVRSGAKTAYQPQQEFVENPK 327

  Fly   294 MSERFDEWTERHMR 307
            :.:..:||.|::::
  Fly   328 LLKSANEWVEQNIK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 84/285 (29%)
St4NP_001286398.1 Sulfotransfer_1 62..311 CDD:279075 80/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
Isobase 1 0.950 - 0 Normalized mean entropy S5749
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - P PTHR11783
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
109.820

Return to query results.
Submit another query.