DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult2a2

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001020302.1 Gene:Sult2a2 / 361510 RGDID:1306542 Length:285 Species:Rattus norvegicus


Alignment Length:275 Identity:77/275 - (28%)
Similarity:132/275 - (48%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLD--YVAAEQDLRL--RSPLIELSALF 103
            |..|.:...|.:||:.:::||::|:.|..|:|.|:..:.|  ::   |.:.:  |||.||.    
  Rat    23 LENSCKKFVVKEDDLIILTYPKSGTNWLIEIVCLIQTKGDPKWI---QSMPIWDRSPWIET---- 80

  Fly   104 SIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHY 168
                        |:..|.:..:..||...||||..|..:...:.|.:::|..|||:|:.||.|.:
  Rat    81 ------------GSGYDKLTKMEGPRLMTSHLPMHLFSKSLFSSKAKVIYLIRNPRDVLVSAYFF 133

  Fly   169 FK--LLHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRC 231
            :.  .|.........:|:.||:|:...||::.|:..:....:.||.|.:.||||.||....:::.
  Rat   134 WSKIALEKKPDSLGTYVEWFLKGNVAYGSWFEHIRGWLSMREWDNFLVLYYEDMKKDTMGSIKKI 198

  Fly   232 ARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVN---LEKLLPESSSKFIRNGKIGDWRNHMGNE 293
            ..|||.:  |:...|..:..:.:|..::.|...|   :||.|..:...|:|.|...||:||....
  Rat   199 CDFLGKK--LEPDELNLVLKYSSFQVVKENNMSNYSLMEKELILTGFTFMRKGTTNDWKNHFTVA 261

  Fly   294 MSERFDEWTERHMRG 308
            .:|.||:..:..|.|
  Rat   262 QAEAFDKVFQEKMAG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 74/263 (28%)
Sult2a2NP_001020302.1 Sulfotransfer_1 34..278 CDD:279075 74/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9151
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.